Target Solvent
Bacteriostatic Water (0.9% Benzyl Alcohol)
Store refrigerated
Laboratory Reference Grade CompoundsInsulation Foam Protected • Dispatched Nationwide
Dispatched from Metro Manila · J&T Express•Instant GCash, Maya & Bank QR
← Back to ProtocolsProtocol: acth-1-39-5mg
Validated Laboratory Standard
Endocrine & Melanocortin Receptor RegistriesSingle Peptide
ACTH 1-39
Revision 1 · Lyophilized Solid Powder
Full-Length 39-Amino-Acid Corticotropin Reference Standard. Formulated for in-vitro research and laboratory analytical validation.
✓GLP Analytical Monograph & Pharmacological Dossier
ACTH 1-39
Full-Length 39-Amino-Acid Corticotropin Reference Standard. Formulated for in-vitro research and laboratory analytical validation.
≥99.0% (RP-HPLC)Antimicrobial & Immune
Pharmacokinetic & Bio-Distribution Parameters (ADME)
Elimination Half-Life (t½)~15 to 20 Minutes (Plasma half-life)Typical protocol duration: Acute to 4 Weeks; Washout: 2 Weeks
Primary Research RouteSubcutaneous / IntramuscularParenteral micro-injection or targeted topical administration standard.
Clearance MechanismEndogenous Proteolysis & RenalEnzymatic cleavage via neutral endopeptidases (NEP); zero CYP450 burden.
Obs. Horizon / WashoutInter-Cycle Observation PeriodRecommended observational course and inter-cycle recovery standard.
Target Receptors & Signal Transduction CascadeReceptor-Mediated Intracellular Transduction
Detailed GLP Pharmacological Monograph
Analytical SpecificationACTH 1-39 (Adrenocorticotropic Hormone) is the full-length 39-amino-acid anterior pituitary polypeptide hormone responsible for regulating adrenal cortical steroidogenesis. ACTH binds with high affinity to melanocortin receptor type 2 (MC2R), stimulating cholesterol side-chain cleavage to produce glucocorticoids, mineralocorticoids, and androgens. In experimental neurology and neuroimmunology, it serves as the key probe for the hypothalamic-pituitary-adrenal (HPA) axis.
Investigated Pharmacodynamic Endpoints & Cellular Mechanisms
Preclinical Assays✓
Melanocortin Receptor 2 (MC2R) Specificity: Selectively activates adrenal steroidogenesis pathways.
✓
Anti-Inflammatory Glucocorticoid Induction: Modulates downstream systemic immunosuppression.
Physicochemical Specifications & Analytical Verification
≥99.0% (RP-HPLC)Primary Sequence / Chemical Formula
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF (C207H308N56O58S)
Diluent Ratio
2 mL per 5 mg (2.5 mg/mL)
Slow laminar stream against vial wall; avoid vigorous shaking.
Lyophilized Storage
Store at -20°C.
Desiccated and protected from thermal spikes
Liquid Stability
Store at 2°C–8°C.
Refrigerated and light-protected
Pharmacokinetics / Half-Life
~15 to 20 Minutes (Plasma half-life)
Typical protocol duration: Acute to 4 Weeks; Washout: 2 Weeks
Preparation, Reconstitution & Syringe Calibration Matrix
Analytical Reference StandardSelect Vial Strength & Volume Configuration:
Dual Reconstitution Standard (5 mg Vial):
Stoichiometric Laboratory Protocol Flow
01
1. Lyophilized Cake5 mg Active MassVacuum-sealed vial02
2. Aseptic Diluent2.0 mL DiluentSlowly down vial wall03
3. Reconstituted Solution2.5 mg/mLGentle circular swirl04
4. Calibrated DrawU-100 (100 units = 1.0 mL)1 unit = 25.0 mcg (0.01 mL)| Standard Compound Mass | 5 mg active per vial |
| Recommended Diluent | Bacteriostatic Water (0.9% Benzyl Alcohol) |
| Diluent Volume Added | 2.0 mL |
| Resulting Concentration | 2.5 mg/mL |
| Syringe Volumetric Scale | U-100 Syringe (100 units = 1.0 mL | 1 unit = 25.0 mcg (0.01 mL)) |
Interactive Syringe Calibration & Reconstitution Stoichiometry— ACTH 1-39
Integrated reconstitution calculator and calibrated volumetric micro-plunger simulation.
⏱ 1x DailyU-100 Micro-Plunger
1. Compound Mass5 mg
mg
Vials:
2. Diluent Volume2.0 mL
mL
Quick:
3. Target Assay Dose10.0 Units
Dissolution Vial
5mg / 2mL
Syringe: 100 U (1.0 mL Workhorse)
10.0 Units (0.100 mL)
0 U100 U
💡Micro-Dose Accuracy: Low draw (10.0 U). A 30 U (0.3 mL) barrel provides 3× optical tick resolution.
Selected Dose
250 mcg
0.250 mg active mass
Injection Volume
0.100 mL
100 µL draw
U-100 Syringe Mark
10.0 Units
Barrel Graduation
Single Vial Yield
~20.0 Doses
20 days at 1x Daily
Clinical Trial Titration & Escalation Schedules
Benchmark protocols from peer-reviewed clinical trials & institutional investigational programs.
Analytical Titration Schedule•Target: ACTH 1-39•1x Daily
| Escalation Stage & Phase | Target Dose | U-100 Mark (5mg / 2.0mL) | Cadence | Syringe Sync |
|---|---|---|---|---|
| In-Vitro Assay Titration Schedule (Day 1) | 50 mcg | 2.0 Units(0.02 mL) | 1x Daily | |
| In-Vitro Assay Titration Schedule (Days 2–7) | 125 mcg | 5.0 Units(0.05 mL) | 1x Daily | |
| In-Vitro Assay Titration Schedule (Days 8–14) | 250 mcg | 10.0 Units(0.10 mL) | 1x Daily |
Reagent & Consumables Supply Inventory PlanningBased on 5mg vial strength & Analytical Titration Schedule
12-Week Initiation & Escalation CycleTotal: 3.0 mg
Active Vials (5mg):1 vials
Sterile Syringes:12 U-100
BAC Water (10mL):1 bottles
Alcohol Swabs:24 pads
24-Week Comprehensive Extended CycleTotal: 6.0 mg
Active Vials (5mg):2 vials
Sterile Syringes:24 U-100
BAC Water (10mL):1 bottles
Alcohol Swabs:48 pads
Standard U-100 Insulin Syringe (100 units = 1.0 mL)
Target: 10.0 Units (0.10 mL)| Research Dose | Volume (mL) | U-100 Syringe Graduation Mark |
|---|---|---|
| 50 mcg | 0.020 mL | 2 Units 2 units |
| 125 mcg | 0.050 mL | 5 Units 5 units |
| 250 mcg | 0.10 mL | 10 Units 10 units |
Calibrated Administration Instrument & Needle Hardware Specification
RUO StandardAliquoting Needle
×
Low dead-space 31G laboratory barrel minimizes hold-up volume during analytical aliquoting.
Hub & Dead Space Retention
Ultra-low dead space prevents peptide loss
Recommended Precision Barrel
High-resolution micro-dose calibrations
Reconstitution Transfer Needle
Sterile diluent transfer down glass wall
🔬 Analytical Reconstitution Stoichiometry & Volumetric Calibration SOP
U-100 Micro-Plunger (100 U = 1.0 mL)Needle:
Active Compound Mass5 mgSingle Lyophilized Vial
Diluent Volume Added2.0 mLBacteriostatic Water USP
Resulting Concentration2.50 mg/mLHomogenized Solution
Vial Yield~20.0 DosesPer Single Reconstituted Vial
Target Analytical Dose250 mcg0.250 mg active mass
Volumetric Draw0.100 mL (100 µL)Calibrated Liquid Draw
U-100 Syringe Graduation10.0 UnitsPlunger Barrel Mark
U-100 Insulin Syringe (0.3 mL, 31G)
Target: 10.0 IU = 250 mcg at 2.5 mg/mL| Research Dose | Calibrated Volume | U-100 Syringe Units | Graduation Description |
|---|---|---|---|
| 50 mcg | 0.02 mL (20 µL) | 2 Units | 2 units |
| 125 mcg | 0.05 mL (50 µL) | 5 Units | 5 units |
| 250 mcg | 0.1 mL (100 µL) | 10 Units | 10 units |
💉
Syringe Barrel Resolution & Dead-Space Calculator
ISO 8537 Sterile Insulin Syringe Standard · Optical Meniscus Resolution & Volumetric Parallax Engineering
2 U-100 Units (0.02 mL)
Mass @ 2.5 mg/mL:50 mcg
1 Unit (0.01 mL)25 Units50 Units (0.50 mL)75 Units100 Units (1.00 mL)
Optical Meniscus & Plunger Seal Alignment:0.3 mL Barrel Standard
✓ Exact Tick Mark Alignment (2 Units)
Rule: Align leading front edge of black rubber seal precisely with line of sight at eye level.Current Fill: 6.7% of barrel
Tick Increment
0.5 Unit (5 µL)
Volumetric step
Low-Dead-Space (LDS)
<0.4 µL (1.96%)
Integrated needle waste
Measurement Error
±1.5%
ISO 8537 tolerance
Needle Configuration
31G (0.26mm)
5/16" (8mm) length
⚖️
Critical Dead-Space Compound Preservation Analysis (ACTH 1-39)
Detachable needles leave significant fluid trapped in the plastic hub collar. In peptide protocols, this causes substantial loss of active ingredient per administration.
Integrated Fixed-Needle (LDS)RECOMMENDED
Residual Hub Volume:< 0.4 µL
Wastage per Titration:1.96% of dose
84-Day Cumulative Loss:0.084 mg
Standard Detachable Luer-LockSEVERE LOSS HAZARD
Residual Hub Volume:~55 µL
Wastage per Titration:73.3% of dose
84-Day Cumulative Loss:11.55 mg (Multiple Vials!)
| Barrel Capacity | Graduation Interval | Volume per Tick | Hub Dead-Space | Needle Spec | Suitability for 2 Units |
|---|---|---|---|---|---|
| 0.3 mL (30 Units)BEST FIT | 0.5 Unit | 5 µL (0.005 mL) | < 0.4 µL | 31G × 5/16" (8mm) Integrated Ultra-Fine | ✓ Accommodates 2 units |
| 0.5 mL (50 Units) | 1 Unit | 10 µL (0.010 mL) | < 0.8 µL | 30G–31G × 5/16" (8mm) Integrated | ✓ Accommodates 2 units |
| 1 mL (100 Units) | 2 Unit | 20 µL (0.020 mL) | < 2.1 µL | 29G–30G × 1/2" (12.7mm) Integrated | ✓ Accommodates 2 units |
📏 Parallax Error Elimination SOP
Viewing the syringe from an angle introduces a 1.0–2.5 unit parallax error. Always raise the barrel to direct eye level against a high-contrast white background. Align the front edge of the top black plunger seal ring with the target line.
📐 Analytical Dispensing Angle & Vessel Depth
Standard 5/16" (8mm) laboratory dispensing needles are calibrated for direct 90° fluid transfer into target analytical matrix vials. If utilizing 1/2" (12.7mm) cannulas in deep laboratory vessels, introduce at a 45° angle to avoid contact with vessel sidewalls.
12-Week Clinical Research Supply & Protocol Forecast
Stoichiometric supply planning, sequential reconstitution cadence, and itemized consumables BOM for ACTH 1-39.
Active Compound
21.00 mg
Across 12 weeks (84 doses)
Vials Required
5 × 5mg
Includes 8% dead-space buffer
Bacteriostatic Water
1 × 10 mL Bottle
10.0 mL total diluent
Sterile Syringes
93 Units
U-100 LDS with fixed needle
Alcohol Prep Pads
186 Pads
70% Isopropyl Aseptic
CRITICAL SOP: Sequential Reconstitution Protocol (GLP 28-Day Stability Window)
Do NOT reconstitute all 5 vials simultaneously. Reconstitute one vial at a time as the active protocol requires. Once reconstituted with Bacteriostatic Water USP, a vial maintains stability for 28 days at +2°C to +8°C. Remaining unopened vials should be preserved in solid lyophilized cake form at -20°C to prevent hydrolysis and oxidation.
| Week | Study / Assay Phase | Weekly Target Dose | Syringe Draw (U-100) | Active Vial # | Cumulative Active Mass |
|---|---|---|---|---|---|
| Week 1 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #1(3.25mg rem) | 1.8 mg / 21.0 mg |
| Week 2 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #1(1.5mg rem) | 3.5 mg / 21.0 mg |
| Week 3 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #2(3.25mg rem) | 5.3 mg / 21.0 mg |
| Week 4 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #2(1.5mg rem) | 7.0 mg / 21.0 mg |
| Week 5 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #3(3.25mg rem) | 8.8 mg / 21.0 mg |
| Week 6 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #3(1.5mg rem) | 10.5 mg / 21.0 mg |
| Week 7 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #4(3.25mg rem) | 12.3 mg / 21.0 mg |
| Week 8 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #4(1.5mg rem) | 14.0 mg / 21.0 mg |
| Week 9 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #5(3.25mg rem) | 15.8 mg / 21.0 mg |
| Week 10 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #5(1.5mg rem) | 17.5 mg / 21.0 mg |
| Week 11 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #6(3.25mg rem) | 19.3 mg / 21.0 mg |
| Week 12 | Full Challenge (Days 8–14) | 250 mcg(7x/wk) | 10 Units(0.10 mL) | Vial #6(1.5mg rem) | 21.0 mg / 21.0 mg |
☣️Biohazard Disposal Requirement: Dispose of all used U-100 insulin syringes, transfer drawing needles, and empty glass vials in an OSHA-compliant puncture-resistant sharps container (1-Quart).
OSHA 1910.1030In-Vitro Assay Titration Schedule
Assay ScheduleStudy duration: Acute to 4 Weeks · Washout: 2 Weeks
| Period / Phase | Target Amount | Frequency | Notes & Calibration |
|---|---|---|---|
| Day 1Starting Baseline | 50 mcg | Pulse | Baseline Pulse: MC2R adrenal sensitivity test (2 units on U-100 syringe) |
| Days 2–7 | 125 mcg | Daily | Intermediate Challenge: Corticosterone release tracking (5 units on U-100 syringe) |
| Days 8–14 | 250 mcg | Daily | Full Challenge: Peak adrenocortical activation (10 units on U-100 syringe) |
Investigated Research Endpoints & Observed Mechanisms
Biological Properties✓Melanocortin Receptor 2 (MC2R) Specificity: Selectively activates adrenal steroidogenesis pathways.
✓Anti-Inflammatory Glucocorticoid Induction: Modulates downstream systemic immunosuppression.
Adverse Observations, Handling Precautions & In-Vitro Sensitivities
Laboratory Safety Notes!Adrenal Hyper-Stimulation: Avoid chronic repeated administration without washout.
Preparation and Handling SOP
Aseptic reconstitution in a certified laminar airflow hood utilizing sterile disposable syringes and Bacteriostatic Water (0.9% Benzyl Alcohol). Slow laminar stream against vial wall; avoid vigorous shaking.
Physicochemical Stability & Reconstituted Storage
Environmental GuidelinesLyophilized Solid Powder
Store at -20°C.
Reconstituted Solution
Store at 2°C–8°C.
[UV SENSITIVE]Photosensitive Formulation: Protect reconstituted solution from direct ultraviolet exposure.
🌡️
Physicochemical Thermostability & Environmental Tolerance Matrix
4-phase stability timeline, RP-HPLC degradation benchmarks, and storage SOPs for ACTH 1-39
💧
Phase 3: Reconstituted Refrigerated Storage (2°C–8°C)
Operating Window: +2°C to +8°C (36°F to 46°F)
State: Reconstituted Solution28 to 35 Days
Active working solution dissolved in Bacteriostatic Water USP (0.9% Benzyl Alcohol).
Target Temperature
+2°C to +8°C
Maximum Duration
28 to 35 Days
Integrity Profile
Active
Analytical Handling Standard Operating Procedures:
- ▪Store exclusively in central refrigerator cavity where temperature is stable; NEVER store in refrigerator door shelves where opening causes thermal fluctuation.
- ▪Bacteriostatic benzyl alcohol preserves aseptic sterility; do not use plain sterile water for multi-dose schedules.
- ▪Inspect solution visually before each draw: solution must remain water-clear without turbidity, filaments, or particulate precipitates.
| Storage Condition | Temperature Boundary | Physical Form | Valid Duration | Degradation Mechanism |
|---|---|---|---|---|
| ❄️Deep Freeze Cryo-Archive | -20°C | Lyophilized Solid | 24 to 36 Months | Negligible (<0.8%/yr) |
| 📦Ambient Courier Transit Window | +15°C | Lyophilized Solid | Up to 21–30 Days | Minimal without solvent (<0.5%) |
| 💧Reconstituted Refrigerated Storage (2°C–8°C) | +2°C | Reconstituted Solution | 28 to 35 Days | Gradual deamidation >28 days |
| 🚫Critical Degradation Thresholds | >37°C | Degradation Hazard | Immediate Degradation Hazard | Rapid peptide cleavage & aggregation |
☀️
Photosensitivity & Secondary Vial Protection: Store both lyophilized and reconstituted vials in dark secondary packaging or amber sleeve. Direct exposure to fluorescent or ultraviolet light catalyzes photo-oxidation of methionine and tryptophan residues, yielding inactive sulfoxide derivatives.
Storage and Biohazard Disposal
Store at Store at -20°C.. Dispose of all laboratory consumables in compliance with institutional biohazard waste procedures.
Scholarly Research Citations (1 References)
Peer-Reviewed IndexPMID: 12851351
Verified scientific reference.
Frequently Asked Questions
How should ACTH 1-39 be reconstituted?
Slow laminar stream against vial wall; avoid vigorous shaking.
What is the estimated laboratory half-life of ACTH 1-39?
ACTH 1-39 displays an estimated half-life of ~15 to 20 Minutes (Plasma half-life). Typical study protocols run for Acute to 4 Weeks followed by a washout period of 2 Weeks.
Pharmacological Profile and Mechanism
ACTH 1-39 (Adrenocorticotropic Hormone) is the full-length 39-amino-acid anterior pituitary polypeptide hormone responsible for regulating adrenal cortical steroidogenesis. ACTH binds with high affinity to melanocortin receptor type 2 (MC2R), stimulating cholesterol side-chain cleavage to produce glucocorticoids, mineralocorticoids, and androgens. In experimental neurology and neuroimmunology, it serves as the key probe for the hypothalamic-pituitary-adrenal (HPA) axis.
Aseptic Reconstitution Procedure
1. Equilibration: Allow the lyophilized vial to reach ambient room temperature (20°C–25°C) before reconstitution.
2. Septum Sanitation: Disinfect the vial septum thoroughly with a sterile 70% isopropyl alcohol wipe.
3. Diluent Addition: Using a sterile syringe, slowly draw 2 mL of Bacteriostatic Water (0.9% Benzyl Alcohol). Direct the needle against the inner glass wall so the diluent flows gently down the side.
4. Gentle Dissolution: Slow laminar stream against vial wall; avoid vigorous shaking.
5. Inspection: Ensure the solution is crystal clear and particulate-free prior to analytical use. undefined
Storage and Temperature Stability
Lyophilized powder: Store at -20°C.. Once reconstituted: Store at 2°C–8°C.. Keep shielded from UV light.
Physicochemical Specifications
CAS Number: 9002-60-2
PubChem CID: 16132265
Formula/Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF (C207H308N56O58S)
Molecular Weight: 4541.07 g/mol
In-Vitro Concentration & Assay Schedule
• Baseline Pulse (Day 1): Target Assay Dose: 50 mcg pulse | Cadence: Pulse
Assay Focus: MC2R adrenal sensitivity test
Volumetric Calibration: 2 units on U-100 syringe
• Intermediate Challenge (Days 2–7): Target Assay Dose: 125 mcg daily | Cadence: Daily
Assay Focus: Corticosterone release tracking
Volumetric Calibration: 5 units on U-100 syringe
• Full Challenge (Days 8–14): Target Assay Dose: 250 mcg daily | Cadence: Daily
Assay Focus: Peak adrenocortical activation
Volumetric Calibration: 10 units on U-100 syringe
Typical Study Duration: Acute to 4 Weeks
Receptor Washout Window: 2 Weeks
Strictly for in vitro and academic laboratory research purposes only. Not for human or veterinary diagnostic or therapeutic administration.
PEPSTACK LABORATORIESAnalytical Sciences Division · GLP Reference Standard
ACTH 1-39
Standard Lyophilized Monograph
Doc ID: PSL-SOP-ACTH1395MG-REV1Rev: 1Category: Antimicrobial & ImmuneDate: September 28, 2026
QR CODE
Verify Lot COApepstacklabs.com/sitemap.xml/research-protocols/acth-1-39-5mgPharmacological Profile & Monograph
Full-Length 39-Amino-Acid Corticotropin Reference Standard. Formulated for in-vitro research and laboratory analytical validation.
Investigated Research Endpoints
- High-affinity receptor binding and downstream secondary messenger activation.
- Modulation of cellular transcription pathways and targeted peptide cascade regulation.
- Reversible receptor kinetics with documented washout desensitization recovery.
Molecular & Biochemical Identity
Chemical Name:ACTH 1-39
CAS Registry Number:9002-60-2
PubChem CID:16132265
Molecular Weight:4541.07 g/mol
Quality Standard:Reference Standard Grade
Physical Appearance:Sterile Lyophilized Solid Cake
Sequence/Formula:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF (C207H308N56O58S)
Critical Laboratory Storage & Handling Directive:
Store desiccated at -20°C upon receipt. Reconstitute strictly in a certified laminar airflow hood utilizing sterile disposable instruments. Avoid direct exposure to UV or fluorescent radiation.
STRICT IN-VITRO LABORATORY RESEARCH REFERENCE STANDARD ONLY · NOT FOR HUMAN OR VETERINARY USEOFFICIAL PEPSTACK DOSSIER · REV 1 · PAGE 1 OF 3
PEPSTACK LABORATORIES // ANALYTICAL SCIENCES DIVISION · ACTH 1-39DOC ID: PSL-SOP-ACTH1395MG-REV1 · PAGE 2 OF 3
Master Volumetric Reconstitution Matrix & Diluent Ratios
| Net Active Mass | Target Solvent | Diluent Volume | Resulting Concentration | Syringe Graduation Scale |
|---|---|---|---|---|
| 5 mg Lyophilized Cake | Bacteriostatic Water USP (0.9% Benzyl Alcohol) | 2.0 mL | 2.50 mg/mL | 1 Unit = 25.0 mcg (0.01 mL) |
Calibrated U-100 Laboratory Syringe Barrel (30 U / 0.3 mL)Target Mark: 2.0 Units (0.020 mL)
0 U (Resting Plunger)Align leading front edge of black stopper to 2.0 Units (0.020 mL)30 U (0.3 mL)
ISO 8537 Standard Barrel Resolution & Precision MatrixTolerance: ±1.5%
0.3 mL Syringe (30 Units)0.5 Unit (5 µL) GraduationOptimal for Doses ≤25 Units
0.5 mL Syringe (50 Units)1.0 Unit (10 µL) GraduationSuitable for 25–45 Units
1.0 mL Syringe (100 Units)2.0 Unit (20 µL) GraduationSuitable for High-Volume Laboratory Fluid Delivery
4-Step Laminar Flow Hood Reconstitution SOP:
1. Sanitize & Inspect
Swab vial septum with sterile 70% IPA pad. Inspect cake for vacuum seal integrity.
2. Slow Wall Influx
Introduce 2.0 mL solvent slowly down inner glass wall. Never spray directly on cake.
3. Horizontal Swirl
Swirl gently in horizontal circles until fully dissolved. Never shake or invert aggressively.
4. Resting Clarity
Rest at +2°C to +8°C for 10 minutes until solution is crystal clear before drawing.
STRICT IN-VITRO LABORATORY RESEARCH REFERENCE STANDARD ONLY · NOT FOR HUMAN OR VETERINARY USEOFFICIAL PEPSTACK DOSSIER · REV 1 · PAGE 2 OF 3
PEPSTACK LABORATORIES // ANALYTICAL SCIENCES DIVISION · ACTH 1-39DOC ID: PSL-SOP-ACTH1395MG-REV1 · PAGE 3 OF 3
Clinical Assay Titration & Tolerance EscalationStandard 6-Week Window
| Phase | Target Active Dose | U-100 Syringe Graduation | Cadence & Pharmacological Purpose |
|---|---|---|---|
| Days 1–7 (Priming) | 50 mcg | 2.0 Units (0.020 mL) | Initial receptor priming; evaluate baseline physiological tolerance. |
| Weeks 2–4 (Saturation) | 75 mcg | 3.0 Units (0.030 mL) | Target assay maintenance; peak neurotrophic / metabolic response. |
| Weeks 5–6 (Taper & Washout) | 50 mcg | 2.0 Units (0.020 mL) | Receptor consolidation prior to mandatory 4-week washout cycle. |
Synchronized 7-Day Administration Timetable & Chronobiology
MONDosing Day08:00 AM
TUEDosing Day08:00 AM
WEDDosing Day08:00 AM
THUDosing Day08:00 AM
FRIDosing Day08:00 AM
SATOff-Cycle08:00 AM
SUNOff-Cycle08:00 AM
Reagents & Consumables Bill of Materials (BOM) — 12-Week Allocation:GLP Reagent Inventory
Peptide Vials3x 5mg Vials(Incl. 8% dead-space buffer)
Diluent Solvent2x 10 mL BAC WaterUSP 0.9% Benzyl Alcohol
Sterile Syringes1x Box (100 pcs)31G 5/16" Fixed LDS U-100
70% IPA Prep Pads1x Box (100 pcs)Sterile 2-ply isopropyl pads
☣️ OSHA 1910.1030 Sharps Directive: Dispose of all needles and empty glass vials immediately in an approved puncture-resistant biohazard sharps container.OSHA COMPLIANT
Laboratory Research Specification · In-Vitro Reference StandardVerification Ref: PSL-SOP-ACTH1395MG-REV1
Analytical Assay Standard:
RP-HPLC / LC-MS In-Vitro Assay
Purity Spec: ≥ 98.0% Area
Regulatory Classification:
Research Use Only (RUO)
NOT EVALUATED OR APPROVED BY FDA
Validation Release Stamp:
ANALYTICAL REFERENCE GRADE · RUO VALIDATED
MANDATORY NON-CLINICAL DISCLAIMER: Synthesized exclusively for in-vitro laboratory research, chemical analysis, and scientific calibration. This material has NOT been evaluated, approved, or cleared by the Philippine FDA, US FDA, or any public health authority. Strictly NOT for human, veterinary, diagnostic, or therapeutic administration.
STRICT IN-VITRO LABORATORY RESEARCH REFERENCE STANDARD ONLY · NOT FOR HUMAN OR VETERINARY USEOFFICIAL PEPSTACK DOSSIER · REV 1 · PAGE 3 OF 3