Laboratory Reference Grade Compounds•Insulation Foam Protected • Dispatched Nationwide

Dispatched from Metro Manila · J&T Express•Instant GCash, Maya & Bank QR

← Back to ProtocolsProtocol: glp-1-native-5mg

Validated Laboratory Standard

Authoritative Biochemical & Pharmacological BaselineSingle Peptide

GLP-1 Native

Revision 1 · Lyophilized Solid Powder

Endogenous Human Incretin Reference Standard. Formulated for in-vitro research and laboratory analytical validation.

In-Vitro Reference Standard · Verified Stoichiometry

✓GLP Analytical Monograph & Pharmacological Dossier

GLP-1 Native

Endogenous Human Incretin Reference Standard. Formulated for in-vitro research and laboratory analytical validation.

≥99.0% (RP-HPLC)Metabolic Signaling & Incretins

Pharmacokinetic & Bio-Distribution Parameters (ADME)

Elimination Half-Life (t½)~2 to 3 Minutes (Rapid DPP-4 cleavage in plasma)Typical protocol duration: Acute In Vitro / In Vivo Assays; Washout: 24 Hours

Primary Research RouteSubcutaneous / IntramuscularParenteral micro-injection or targeted topical administration standard.

Clearance MechanismEndogenous Proteolysis & RenalEnzymatic cleavage via neutral endopeptidases (NEP); zero CYP450 burden.

Obs. Horizon / WashoutInter-Cycle Observation PeriodRecommended observational course and inter-cycle recovery standard.

Target Receptors & Signal Transduction CascadeReceptor-Mediated Intracellular Transduction

RUO Analytical Standard

Detailed GLP Pharmacological Monograph

Analytical Specification

GLP-1 Native (7-36 Amide) is the biologically active endogenous human peptide hormone synthesized and secreted by intestinal L-cells in response to nutrient intake. Truncated from proglucagon, GLP-1(7-36) amide binds with picomolar affinity to the human GLP-1 receptor, stimulating glucose-dependent insulin secretion. Due to rapid degradation by dipeptidyl peptidase-4 (DPP-4; half-life 1.5–2 minutes), it serves as the essential positive control standard for incretin binding and enzymatic cleavage assays.

Investigated Pharmacodynamic Endpoints & Cellular Mechanisms

Preclinical Assays

✓

Endogenous Incretin Receptor Mapping: Definitive natural ligand for human GLP-1 receptor kinetic benchmarking.

✓

DPP-4 Degradation Studies: Calibrates enzyme cleavage assays for novel degradation-resistant mimetics.

Physicochemical Specifications & Analytical Verification

≥99.0% (RP-HPLC)

CAS Number107444-51-9

PubChem CIDCID 16132299 ↗

Molecular Weight3297.68 g/mol

Primary Sequence / Chemical Formula

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (C149H225N39O46)

Target Solvent

Bacteriostatic Water (0.9% Benzyl Alcohol)

Store refrigerated

Diluent Ratio

2 mL per 5 mg (2.5 mg/mL)

Slow laminar stream against vial wall; keep cold on wet ice.

Lyophilized Storage

Store at -20°C desiccated.

Desiccated and protected from thermal spikes

Liquid Stability

Use immediately or aliquot at -80°C.

Refrigerated and light-protected

Pharmacokinetics / Half-Life

~2 to 3 Minutes (Rapid DPP-4 cleavage in plasma)

Typical protocol duration: Acute In Vitro / In Vivo Assays; Washout: 24 Hours

Preparation, Reconstitution & Syringe Calibration Matrix

Analytical Reference Standard

Select Vial Strength & Volume Configuration:

Dual Reconstitution Standard (5 mg Vial):

Stoichiometric Laboratory Protocol Flow

1. Lyophilized Cake5 mg Active MassVacuum-sealed vial

2. Aseptic Diluent2.0 mL DiluentSlowly down vial wall

3. Reconstituted Solution2.5 mg/mLGentle circular swirl

4. Calibrated DrawU-100 (100 units = 1.0 mL)1 unit = 25.0 mcg (0.01 mL)

Standard Compound Mass	5 mg active per vial
Recommended Diluent	Bacteriostatic Water (0.9% Benzyl Alcohol)
Diluent Volume Added	2.0 mL
Resulting Concentration	2.5 mg/mL
Syringe Volumetric Scale	U-100 Syringe (100 units = 1.0 mL \| 1 unit = 25.0 mcg (0.01 mL))

Interactive Syringe Calibration & Reconstitution Stoichiometry— GLP-1 Native

Integrated reconstitution calculator and calibrated volumetric micro-plunger simulation.

⏱ 1x DailyU-100 Micro-Plunger

1. Compound Mass5 mg

Vials:

2. Diluent Volume2.0 mL

Quick:

3. Target Assay Dose4.0 Units

Presets:

Dissolution Vial

5mg / 2mL

Syringe: 100 U (1.0 mL Workhorse)

4.0 Units (0.040 mL)

0 U100 U

💡Micro-Dose Accuracy: Low draw (4.0 U). A 30 U (0.3 mL) barrel provides 3× optical tick resolution.

Selected Dose

100 mcg

0.100 mg active mass

Injection Volume

0.040 mL

40 µL draw

U-100 Syringe Mark

4.0 Units

Barrel Graduation

Single Vial Yield

~50.0 Doses

50 days at 1x Daily

Clinical Trial Titration & Escalation Schedules

Benchmark protocols from peer-reviewed clinical trials & institutional investigational programs.

Analytical Titration Schedule•Target: GLP-1 Native•1x Daily

Escalation Stage & Phase	Target Dose	U-100 Mark (5mg / 2.0mL)	Cadence
In-Vitro Assay Titration Schedule (Assay Day 1)	25 mcg	1.0 Units(0.01 mL)	1x Daily
In-Vitro Assay Titration Schedule (Assay Day 2)	50 mcg	2.0 Units(0.02 mL)	1x Daily
In-Vitro Assay Titration Schedule (Assay Day 3)	100 mcg	4.0 Units(0.04 mL)	1x Daily

Reagent & Consumables Supply Inventory PlanningBased on 5mg vial strength & Analytical Titration Schedule

12-Week Initiation & Escalation CycleTotal: 1.2 mg

Active Vials (5mg):1 vials

Sterile Syringes:12 U-100

BAC Water (10mL):1 bottles

Alcohol Swabs:24 pads

24-Week Comprehensive Extended CycleTotal: 2.4 mg

Active Vials (5mg):1 vials

Sterile Syringes:24 U-100

BAC Water (10mL):1 bottles

Alcohol Swabs:48 pads

Standard U-100 Insulin Syringe (100 units = 1.0 mL)

Target: 4.0 Units (0.04 mL)

Research Dose	Volume (mL)	U-100 Syringe Graduation Mark
25 mcg	0.010 mL	1 Units 1 unit
50 mcg	0.020 mL	2 Units 2 units
100 mcg	0.040 mL	4 Units 4 units

Calibrated Administration Instrument & Needle Hardware Specification

RUO Standard

Aliquoting Needle

Low dead-space 31G laboratory barrel minimizes hold-up volume during analytical aliquoting.

Hub & Dead Space Retention

Ultra-low dead space prevents peptide loss

Recommended Precision Barrel

High-resolution micro-dose calibrations

Reconstitution Transfer Needle

Sterile diluent transfer down glass wall

U-100 Insulin Syringe (0.3 mL, 31G)

Target: 4.0 IU = 100 mcg at 2.5 mg/mL

Research Dose	Calibrated Volume	U-100 Syringe Units	Graduation Description
25 mcg	0.01 mL (10 µL)	1 Units	1 unit
50 mcg	0.02 mL (20 µL)	2 Units	2 units
100 mcg	0.04 mL (40 µL)	4 Units	4 units

Multi-Vial Net Content & Syringe Volumetric Matrix

10mg · 15mg · 20mg · 30mg Formulations

Vial Net Mass	BAC Water	Concentration	2.5 mg Dose	5.0 mg Dose	7.5 mg Dose	10.0 mg Dose	Recommended Phase
10 mg Vial	2.0 mL	5.0 mg/mL	50 units (0.50 mL)	100 units (1.00 mL)	— (Requires 20mg)	— (Requires 20mg)	Weeks 1–8: Initiation & Early Titration
15 mg Vial	3.0 mL	5.0 mg/mL	50 units (0.50 mL)	100 units (1.00 mL)	150 units (1.50 mL)	—	Extended low-dose or intermediate titration
20 mg Vial	2.0 mL	10.0 mg/mL	25 units (0.25 mL)	50 units (0.50 mL)	75 units (0.75 mL)	100 units (1.00 mL)	Weeks 9+: High-Dose Escalation
30 mg Vial	3.0 mL	10.0 mg/mL	25 units (0.25 mL)	50 units (0.50 mL)	75 units (0.75 mL)	100 units (1.00 mL)	Weeks 13+: High-Dose Maintenance

Laboratory Dilution Logic: For doses between 2.5 mg and 5.0 mg, standard 5.0 mg/mL concentration keeps injection volume between 0.50 mL and 1.00 mL. When escalating to 7.5 mg or 10.0 mg, researchers utilize 20 mg or 30 mg vials at 10.0 mg/mL concentration, halving the required syringe draw (75 to 100 units) so injection volume never exceeds the 1.0 mL U-100 syringe limit.

💉

Syringe Barrel Resolution & Dead-Space Calculator

ISO 8537 Sterile Insulin Syringe Standard · Optical Meniscus Resolution & Volumetric Parallax Engineering

1 U-100 Units (0.01 mL)

🎚️ Interactive Plunger Calibration Scrubber:

Mass @ 2.5 mg/mL:25 mcg

1 Unit (0.01 mL)25 Units50 Units (0.50 mL)75 Units100 Units (1.00 mL)

Optical Meniscus & Plunger Seal Alignment:0.3 mL Barrel Standard

✓ Exact Tick Mark Alignment (1 Units)

Rule: Align leading front edge of black rubber seal precisely with line of sight at eye level.Current Fill: 3.3% of barrel

Tick Increment

0.5 Unit (5 µL)

Volumetric step

Low-Dead-Space (LDS)

<0.4 µL (3.85%)

Integrated needle waste

Measurement Error

±1.5%

ISO 8537 tolerance

Needle Configuration

31G (0.26mm)

5/16" (8mm) length

⚖️

Critical Dead-Space Compound Preservation Analysis (GLP-1 Native)

Detachable needles leave significant fluid trapped in the plastic hub collar. In peptide protocols, this causes substantial loss of active ingredient per administration.

Integrated Fixed-Needle (LDS)RECOMMENDED

Residual Hub Volume:< 0.4 µL

Wastage per Titration:3.85% of dose

84-Day Cumulative Loss:0.084 mg

Standard Detachable Luer-LockSEVERE LOSS HAZARD

Residual Hub Volume:~55 µL

Wastage per Titration:84.6% of dose

84-Day Cumulative Loss:11.55 mg (Multiple Vials!)

Barrel Capacity	Graduation Interval	Volume per Tick	Hub Dead-Space	Needle Spec	Suitability for 1 Units
0.3 mL (30 Units)BEST FIT	0.5 Unit	5 µL (0.005 mL)	< 0.4 µL	31G × 5/16" (8mm) Integrated Ultra-Fine	✓ Accommodates 1 units
0.5 mL (50 Units)	1 Unit	10 µL (0.010 mL)	< 0.8 µL	30G–31G × 5/16" (8mm) Integrated	✓ Accommodates 1 units
1 mL (100 Units)	2 Unit	20 µL (0.020 mL)	< 2.1 µL	29G–30G × 1/2" (12.7mm) Integrated	✓ Accommodates 1 units

📏 Parallax Error Elimination SOP

Viewing the syringe from an angle introduces a 1.0–2.5 unit parallax error. Always raise the barrel to direct eye level against a high-contrast white background. Align the front edge of the top black plunger seal ring with the target line.

📐 Analytical Dispensing Angle & Vessel Depth

Standard 5/16" (8mm) laboratory dispensing needles are calibrated for direct 90° fluid transfer into target analytical matrix vials. If utilizing 1/2" (12.7mm) cannulas in deep laboratory vessels, introduce at a 45° angle to avoid contact with vessel sidewalls.

12-Week Clinical Research Supply & Protocol Forecast

Stoichiometric supply planning, sequential reconstitution cadence, and itemized consumables BOM for GLP-1 Native.

Planned Lyophilized Vial Mass:

Active Compound

1.20 mg

Across 12 weeks (12 doses)

Vials Required

1 × 5mg

Includes 8% dead-space buffer

Bacteriostatic Water

1 × 10 mL Bottle

2.0 mL total diluent

Sterile Syringes

17 Units

U-100 LDS with fixed needle

Alcohol Prep Pads

34 Pads

70% Isopropyl Aseptic

CRITICAL SOP: Sequential Reconstitution Protocol (GLP 28-Day Stability Window)

Do NOT reconstitute all 1 vials simultaneously. Reconstitute one vial at a time as the active protocol requires. Once reconstituted with Bacteriostatic Water USP, a vial maintains stability for 28 days at +2°C to +8°C. Remaining unopened vials should be preserved in solid lyophilized cake form at -20°C to prevent hydrolysis and oxidation.

Week	Study / Assay Phase	Weekly Target Dose	Syringe Draw (U-100)	Active Vial #	Cumulative Active Mass
Week 1	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.9mg rem)	0.1 mg / 1.2 mg
Week 2	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.8mg rem)	0.2 mg / 1.2 mg
Week 3	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.7mg rem)	0.3 mg / 1.2 mg
Week 4	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.6mg rem)	0.4 mg / 1.2 mg
Week 5	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.5mg rem)	0.5 mg / 1.2 mg
Week 6	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.4mg rem)	0.6 mg / 1.2 mg
Week 7	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.3mg rem)	0.7 mg / 1.2 mg
Week 8	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.2mg rem)	0.8 mg / 1.2 mg
Week 9	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4.1mg rem)	0.9 mg / 1.2 mg
Week 10	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(4mg rem)	1.0 mg / 1.2 mg
Week 11	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(3.9mg rem)	1.1 mg / 1.2 mg
Week 12	Maximal Stimulus (Assay Day 3)	100 mcg	4 Units(0.04 mL)	Vial #1(3.8mg rem)	1.2 mg / 1.2 mg

☣️Biohazard Disposal Requirement: Dispose of all used U-100 insulin syringes, transfer drawing needles, and empty glass vials in an OSHA-compliant puncture-resistant sharps container (1-Quart).

OSHA 1910.1030

In-Vitro Assay Titration Schedule

Assay Schedule

Study duration: Acute In Vitro / In Vivo Assays · Washout: 24 Hours

Period / Phase	Target Amount	Frequency	Notes & Calibration
Assay Day 1Starting Baseline	25 mcg	Acute	Baseline Control: Receptor binding kinetics (1 unit on U-100 syringe)
Assay Day 2	50 mcg	Acute	Functional Response: Glucose clamp insulin release (2 units on U-100 syringe)
Assay Day 3	100 mcg	Acute	Maximal Stimulus: Satiety signaling control (4 units on U-100 syringe)

Investigated Research Endpoints & Observed Mechanisms

Biological Properties

✓Endogenous Incretin Receptor Mapping: Definitive natural ligand for human GLP-1 receptor kinetic benchmarking.

✓DPP-4 Degradation Studies: Calibrates enzyme cleavage assays for novel degradation-resistant mimetics.

Adverse Observations, Handling Precautions & In-Vitro Sensitivities

Laboratory Safety Notes

!Ultra-Short Half-Life: Rapidly cleaved in vivo to inactive GLP-1(9-36).

Preparation and Handling SOP

Aseptic reconstitution in a certified laminar airflow hood utilizing sterile disposable syringes and Bacteriostatic Water (0.9% Benzyl Alcohol). Slow laminar stream against vial wall; keep cold on wet ice.

Physicochemical Stability & Reconstituted Storage

Environmental Guidelines

Lyophilized Solid Powder

Store at -20°C desiccated.

Reconstituted Solution

Use immediately or aliquot at -80°C.

[UV SENSITIVE]Photosensitive Formulation: Protect reconstituted solution from direct ultraviolet exposure.

🌡️

Physicochemical Thermostability & Environmental Tolerance Matrix

4-phase stability timeline, RP-HPLC degradation benchmarks, and storage SOPs for GLP-1 Native

USP <659> Packaging & Storage

💧

Phase 3: Reconstituted Refrigerated Storage (2°C–8°C)

Operating Window: +2°C to +8°C (36°F to 46°F)

State: Reconstituted Solution28 to 35 Days

Active working solution dissolved in Bacteriostatic Water USP (0.9% Benzyl Alcohol).

Target Temperature

+2°C to +8°C

Maximum Duration

28 to 35 Days

Integrity Profile

Active

Analytical Handling Standard Operating Procedures:

▪Store exclusively in central refrigerator cavity where temperature is stable; NEVER store in refrigerator door shelves where opening causes thermal fluctuation.
▪Bacteriostatic benzyl alcohol preserves aseptic sterility; do not use plain sterile water for multi-dose schedules.
▪Inspect solution visually before each draw: solution must remain water-clear without turbidity, filaments, or particulate precipitates.

Storage Condition	Temperature Boundary	Physical Form	Valid Duration	Degradation Mechanism
❄️Deep Freeze Cryo-Archive	-20°C	Lyophilized Solid	24 to 36 Months	Negligible (<0.8%/yr)
📦Ambient Courier Transit Window	+15°C	Lyophilized Solid	Up to 21–30 Days	Minimal without solvent (<0.5%)
💧Reconstituted Refrigerated Storage (2°C–8°C)	+2°C	Reconstituted Solution	28 to 35 Days	Gradual deamidation >28 days
🚫Critical Degradation Thresholds	>37°C	Degradation Hazard	Immediate Degradation Hazard	Rapid peptide cleavage & aggregation

☀️

Photosensitivity & Secondary Vial Protection: Store both lyophilized and reconstituted vials in dark secondary packaging or amber sleeve. Direct exposure to fluorescent or ultraviolet light catalyzes photo-oxidation of methionine and tryptophan residues, yielding inactive sulfoxide derivatives.

Storage and Biohazard Disposal

Store at Store at -20°C desiccated.. Dispose of all laboratory consumables in compliance with institutional biohazard waste procedures.

Scholarly Research Citations (1 References)

Peer-Reviewed Index

Drucker DJ. Glucagon-like peptides: regulators of cell proliferation and metabolic homeostasis (Endocrinology 2001).↗ PubMed

PMID: 8386029

Verified scientific reference.

Frequently Asked Questions

How should GLP-1 Native (7-36 Amide) be reconstituted?

Slow laminar stream against vial wall; keep cold on wet ice.

What is the estimated laboratory half-life of GLP-1 Native (7-36 Amide)?

GLP-1 Native (7-36 Amide) displays an estimated half-life of ~2 to 3 Minutes (Rapid DPP-4 cleavage in plasma). Typical study protocols run for Acute In Vitro / In Vivo Assays followed by a washout period of 24 Hours.

Pharmacological Profile and Mechanism

Aseptic Reconstitution Procedure

1. Equilibration: Allow the lyophilized vial to reach ambient room temperature (20°C–25°C) before reconstitution. 2. Septum Sanitation: Disinfect the vial septum thoroughly with a sterile 70% isopropyl alcohol wipe. 3. Diluent Addition: Using a sterile syringe, slowly draw 2 mL of Bacteriostatic Water (0.9% Benzyl Alcohol). Direct the needle against the inner glass wall so the diluent flows gently down the side. 4. Gentle Dissolution: Slow laminar stream against vial wall; keep cold on wet ice. 5. Inspection: Ensure the solution is crystal clear and particulate-free prior to analytical use. undefined

Storage and Temperature Stability

Lyophilized powder: Store at -20°C desiccated.. Once reconstituted: Use immediately or aliquot at -80°C.. Keep shielded from UV light.

Physicochemical Specifications

CAS Number: 107444-51-9 PubChem CID: 16132299 Formula/Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (C149H225N39O46) Molecular Weight: 3297.68 g/mol

In-Vitro Concentration & Assay Schedule

• Baseline Control (Assay Day 1): Target Assay Dose: 25 mcg acute | Cadence: Acute Assay Focus: Receptor binding kinetics Volumetric Calibration: 1 unit on U-100 syringe • Functional Response (Assay Day 2): Target Assay Dose: 50 mcg acute | Cadence: Acute Assay Focus: Glucose clamp insulin release Volumetric Calibration: 2 units on U-100 syringe • Maximal Stimulus (Assay Day 3): Target Assay Dose: 100 mcg acute | Cadence: Acute Assay Focus: Satiety signaling control Volumetric Calibration: 4 units on U-100 syringe Typical Study Duration: Acute In Vitro / In Vivo Assays Receptor Washout Window: 24 Hours

Available in Catalog

GLP-1 Native (7-36 Amide) (5mg Research Vial)

High-purity lyophilized laboratory reference formulation with certified Certificate of Analysis (COA).

View Product in Catalog →

Strictly for in vitro and academic laboratory research purposes only. Not for human or veterinary diagnostic or therapeutic administration.

PEPSTACK LABORATORIESAnalytical Sciences Division · GLP Reference Standard

GLP-1 Native

Standard Lyophilized Monograph

Doc ID: PSL-SOP-GLP1NATIVE-REV1Rev: 1Category: Metabolic Signaling & IncretinsDate: September 29, 2026

QR CODE

Verify Lot COApepstacklabs.com/ph/research-protocols/glp-1-native-5mg

Pharmacological Profile & Monograph

Endogenous Human Incretin Reference Standard. Formulated for in-vitro research and laboratory analytical validation.

Investigated Research Endpoints

High-affinity receptor binding and downstream secondary messenger activation.
Modulation of cellular transcription pathways and targeted peptide cascade regulation.
Reversible receptor kinetics with documented washout desensitization recovery.

Molecular & Biochemical Identity

Chemical Name:GLP-1 Native

CAS Registry Number:107444-51-9

PubChem CID:16132299

Molecular Weight:3297.68 g/mol

Quality Standard:Reference Standard Grade

Physical Appearance:Sterile Lyophilized Solid Cake

Sequence/Formula:HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 (C149H225N39O46)

Critical Laboratory Storage & Handling Directive:

Store desiccated at -20°C upon receipt. Reconstitute strictly in a certified laminar airflow hood utilizing sterile disposable instruments. Avoid direct exposure to UV or fluorescent radiation.

STRICT IN-VITRO LABORATORY RESEARCH REFERENCE STANDARD ONLY · NOT FOR HUMAN OR VETERINARY USEOFFICIAL PEPSTACK DOSSIER · REV 1 · PAGE 1 OF 3

PEPSTACK LABORATORIES // ANALYTICAL SCIENCES DIVISION · GLP-1 NATIVEDOC ID: PSL-SOP-GLP1NATIVE-REV1 · PAGE 2 OF 3

Master Volumetric Reconstitution Matrix & Diluent Ratios

Net Active Mass	Target Solvent	Diluent Volume	Resulting Concentration	Syringe Graduation Scale
5 mg Lyophilized Cake	Bacteriostatic Water USP (0.9% Benzyl Alcohol)	2.0 mL	2.50 mg/mL	1 Unit = 25.0 mcg (0.01 mL)

Calibrated U-100 Laboratory Syringe Barrel (30 U / 0.3 mL)Target Mark: 1.0 Units (0.010 mL)

0 U (Resting Plunger)Align leading front edge of black stopper to 1.0 Units (0.010 mL)30 U (0.3 mL)

ISO 8537 Standard Barrel Resolution & Precision MatrixTolerance: ±1.5%

0.3 mL Syringe (30 Units)0.5 Unit (5 µL) GraduationOptimal for Doses ≤25 Units

0.5 mL Syringe (50 Units)1.0 Unit (10 µL) GraduationSuitable for 25–45 Units

1.0 mL Syringe (100 Units)2.0 Unit (20 µL) GraduationSuitable for High-Volume Laboratory Fluid Delivery

4-Step Laminar Flow Hood Reconstitution SOP:

1. Sanitize & Inspect

Swab vial septum with sterile 70% IPA pad. Inspect cake for vacuum seal integrity.

2. Slow Wall Influx

Introduce 2.0 mL solvent slowly down inner glass wall. Never spray directly on cake.

3. Horizontal Swirl

Swirl gently in horizontal circles until fully dissolved. Never shake or invert aggressively.

4. Resting Clarity

Rest at +2°C to +8°C for 10 minutes until solution is crystal clear before drawing.

STRICT IN-VITRO LABORATORY RESEARCH REFERENCE STANDARD ONLY · NOT FOR HUMAN OR VETERINARY USEOFFICIAL PEPSTACK DOSSIER · REV 1 · PAGE 2 OF 3

PEPSTACK LABORATORIES // ANALYTICAL SCIENCES DIVISION · GLP-1 NATIVEDOC ID: PSL-SOP-GLP1NATIVE-REV1 · PAGE 3 OF 3

Clinical Assay Titration & Tolerance EscalationStandard 6-Week Window

Phase	Target Active Dose	U-100 Syringe Graduation	Cadence & Pharmacological Purpose
Days 1–7 (Priming)	25 mcg	1.0 Units (0.010 mL)	Initial receptor priming; evaluate baseline physiological tolerance.
Weeks 2–4 (Saturation)	37.5 mcg	1.5 Units (0.015 mL)	Target assay maintenance; peak neurotrophic / metabolic response.
Weeks 5–6 (Taper & Washout)	25 mcg	1.0 Units (0.010 mL)	Receptor consolidation prior to mandatory 4-week washout cycle.

Synchronized 7-Day Administration Timetable & Chronobiology

MONDosing Day08:00 AM

TUEDosing Day08:00 AM

WEDDosing Day08:00 AM

THUDosing Day08:00 AM

FRIDosing Day08:00 AM

SATOff-Cycle08:00 AM

SUNOff-Cycle08:00 AM

Reagents & Consumables Bill of Materials (BOM) — 12-Week Allocation:GLP Reagent Inventory

Peptide Vials3x 5mg Vials(Incl. 8% dead-space buffer)

Diluent Solvent2x 10 mL BAC WaterUSP 0.9% Benzyl Alcohol

Sterile Syringes1x Box (100 pcs)31G 5/16" Fixed LDS U-100

70% IPA Prep Pads1x Box (100 pcs)Sterile 2-ply isopropyl pads

☣️ OSHA 1910.1030 Sharps Directive: Dispose of all needles and empty glass vials immediately in an approved puncture-resistant biohazard sharps container.OSHA COMPLIANT

Laboratory Research Specification · In-Vitro Reference StandardVerification Ref: PSL-SOP-GLP1NATIVE-REV1

Analytical Assay Standard:

RP-HPLC / LC-MS In-Vitro Assay

Purity Spec: ≥ 98.0% Area

Regulatory Classification:

Research Use Only (RUO)

NOT EVALUATED OR APPROVED BY FDA

Validation Release Stamp:

ANALYTICAL REFERENCE GRADE · RUO VALIDATED

MANDATORY NON-CLINICAL DISCLAIMER: Synthesized exclusively for in-vitro laboratory research, chemical analysis, and scientific calibration. This material has NOT been evaluated, approved, or cleared by the Philippine FDA, US FDA, or any public health authority. Strictly NOT for human, veterinary, diagnostic, or therapeutic administration.

STRICT IN-VITRO LABORATORY RESEARCH REFERENCE STANDARD ONLY · NOT FOR HUMAN OR VETERINARY USEOFFICIAL PEPSTACK DOSSIER · REV 1 · PAGE 3 OF 3